PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA40G00160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 322aa    MW: 36918.7 Da    PI: 8.347
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA40G00160genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
       AA40G00160 14 KGLWSPEEDEKLLNYITRHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding51.91.7e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++eE+ l++++++ lG++ W+ Ia +++ gRt++++k++w++
       AA40G00160  67 RGAFSQEEESLIIELHAALGNR-WSQIATRLP-GRTDNEIKNFWNS 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.4E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.515961IPR017930Myb domain
SuperFamilySSF466891.68E-2912108IPR009057Homeodomain-like
SMARTSM007177.6E-131363IPR001005SANT/Myb domain
PfamPF002493.9E-161461IPR001005SANT/Myb domain
CDDcd001674.01E-111761No hitNo description
PROSITE profilePS5129426.49662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2665116IPR009057Homeodomain-like
SMARTSM007176.6E-1666114IPR001005SANT/Myb domain
PfamPF002493.0E-1567111IPR001005SANT/Myb domain
CDDcd001671.19E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGRHSCCFKQ KLRKGLWSPE EDEKLLNYIT RHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQEEESLIIE LHAALGNRWS QIATRLPGRT DNEIKNFWNS CLKKKLRRKG  120
IDPTTHKPLI NDLHQCLETH DIIDQKLTSS QILKSTASIN QLQDTTTTWC FPTMMTTNQN  180
AAFCNTTTNP TVSDQIVSLI SSMSTSASPT PNYNLVPNNW ELNYNNSVPC QSIYSTFFGN  240
HYTDQTTQIM NNNNTNNNQE MKSWGLEILD QYTDQSCLEI EVKPEINKFY WKSSSSSPPN  300
QLDVTEPILK FVGPQVQNVF KF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596421.11e-144PREDICTED: transcription factor MYB86-like
SwissprotQ8LPH61e-143MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A087G9791e-147A0A087G979_ARAAL; Uncharacterized protein
STRINGAT5G26660.11e-140(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.11e-134myb domain protein 86